| Edit |   |
|---|
| Antigenic Specificity | TBC1D14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TBC1D14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TBC1D14. This antibody reacts with human. The TBC1D14 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TBC1D14(TBC1 domain family, member 14) The peptide sequence was selected from the N terminal of TBC1D14. Peptide sequence MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL. |
|---|
| Other Names | KIAA1322FLJ32400, TBC1 domain family member 14, TBC1 domain family, member 14 |
|---|
| Gene, Accession # | TBC1D14, Gene ID: 57533, Accession: Q9P2M4, SwissProt: Q9P2M4 |
|---|
| Catalog # | NBP1-56837-20ul |
|---|
| Price | |
|---|
| Order / More Info | TBC1D14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|