| Edit |   |
|---|
| Antigenic Specificity | ADCY5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 79%, rat 77%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human ADCY5 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FTCNSRDLLGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNF |
|---|
| Other Names | adenylate cyclase 5, AC5 |
|---|
| Gene, Accession # | Gene ID: 111, UniProt: O95622, ENSG00000173175 |
|---|
| Catalog # | HPA077682 |
|---|
| Price | |
|---|
| Order / More Info | ADCY5 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|