| 产品详情 |
| Edit |   |
| Antigenic Specificity | DHX58 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 27011352). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DHX58 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DHX58. This antibody reacts with human. The DHX58 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DHX58 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS |
| Other Names | D11lgp2e, D11LGP2probable ATP-dependent RNA helicase DHX58, DEXH (Asp-Glu-X-His) box polypeptide 58, EC 3.6.4.13, LGP2ortholog of mouse D11lgp2, Probable ATP-dependent helicase LGP2, Protein D11Lgp2 homolog, RIG-I-like receptor LGP2, RLR, RNA helicase LGP2 |
| Gene, Accession # | DHX58, Gene ID: 79132 |
| Catalog # | NBP1-85348 |
| Price | |
| Order / More Info | DHX58 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 27011352 |
| 产品资料 |
|
|