Edit |   |
Antigenic Specificity | Asparagine-Linked Glycosylation 1 Homolog Pseudogene (LOC339879) (C-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The function of LOC339879 protein is not widely studied, and is yet to be elucidated fully. |
Immunogen | LOC339879 antibody was raised using the C terminal of LOC339879 corresponding to a region with amino acids HELVKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLQESQQL |
Other Names | n/a |
Gene, Accession # | n/a |
Catalog # | ABIN629659 |
Price | |
Order / More Info | Asparagine-Linked Glycosylation 1 Homolog Pseudogene (LOC339879) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |