Edit |   |
Antigenic Specificity | Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ALG1 catalyzes the first mannosylation step in the biosynthesis of lipid-linked oligosaccharides. Defects in ALG1 are the cause of congenital disorder of glycosylation type 1K (CDG1K). |
Immunogen | ALG1 antibody was raised using the N terminal of ALG1 corresponding to a region with amino acids VVLGDVGRSPRMQYHALSLAMHGFSVTLLGFCNSKPHDELLQNNRIQIVG |
Other Names | zgc:66221|wu:fi34b12|CDG1K|HMAT1|HMT-1|HMT1|MT-1|Mat-1|hMat-1 |
Gene, Accession # | Gene ID: 56052 |
Catalog # | ABIN635919 |
Price | |
Order / More Info | Asparagine-Linked Glycosylation 1, beta-1,4-Mannosyltransferase Homolog (S. Cerevisiae) (ALG1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |