| Edit |   |
| Antigenic Specificity | FBXL3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FBXL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXL3. This antibody reacts with human. The FBXL3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human FBXL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDELLLALSS |
| Other Names | FBL3AF-box and leucine-rich repeat protein 3AF-box protein Fbl3a, FBL3F-box/LRR-repeat protein 3, F-box and leucine-rich repeat protein 3, F-box/LRR-repeat protein 3A, FBXL3A |
| Gene, Accession # | FBXL3, Gene ID: 26224 |
| Catalog # | NBP2-58640 |
| Price | |
| Order / More Info | FBXL3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |