| Edit |   |
|---|
| Antigenic Specificity | FBXL22 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FBXL22 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXL22. This antibody reacts with human. The FBXL22 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human FBXL22 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ERPSETPPAPGVSWGPPPPGAPVVISVKQEEGKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ |
|---|
| Other Names | Fbl22, F-box and leucine-rich repeat protein 22FLJ39626, F-box/LRR-repeat protein 22, MGC75496 |
|---|
| Gene, Accession # | FBXL22, Gene ID: 283807, Accession: Q6P050, SwissProt: Q6P050 |
|---|
| Catalog # | NBP2-33724 |
|---|
| Price | |
|---|
| Order / More Info | FBXL22 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|