| 产品详情 |
| Edit |   |
| Antigenic Specificity | ATG14L? |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat (predicted: hamster) |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100ug (sample available) |
| Concentration | 500ug/ml. |
| Applications | Flow Cytometry, IHC, ICC, WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit IgG polyclonal Picoband™ antibody for Beclin 1-associated autophagy-related key regulator (ATG14) detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human;Rat. No cross reactivity with other proteins. ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes. |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids. |
| Other Names | Beclin 1-associated autophagy-related key regulator ;Barkor ;Autophagy-related protein 14-like protein ;Atg14L ;ATG14 ;ATG14L , KIAA0831; |
| Gene, Accession # | ATG14, UniProt: Q6ZNE5 |
| Catalog # | PB9481 |
| Price | |
| Order / More Info | ATG14L? Antibody from BOSTER BIO |
| Product Specific References | n/a |
| 产品资料 |
|
|