Edit |   |
Antigenic Specificity | EF-Hand Domain Family, Member A2 (EFHA2) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The function of EFHA protein is not widely studied, and is yet to be elucidated fully. |
Immunogen | EFHA2 antibody was raised using the N terminal of EFHA2 corresponding to a region with amino acids TLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQ |
Other Names | EFHA2|2900075B16Rik|Efha2 |
Gene, Accession # | Gene ID: 286097 |
Catalog # | ABIN632049 |
Price | |
Order / More Info | EF-Hand Domain Family, Member A2 (EFHA2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |