| Edit |   |
|---|
| Antigenic Specificity | LRP5L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 54%, rat 54%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human LRP5L polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: VIIDQLPDLMGLKAVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWN |
|---|
| Other Names | low density lipoprotein receptor-related protein 5-like, DKFZp434O0213 |
|---|
| Gene, Accession # | Gene ID: 91355, UniProt: A4QPB2, ENSG00000100068 |
|---|
| Catalog # | HPA028717 |
|---|
| Price | |
|---|
| Order / More Info | LRP5L Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|