| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Metallothionein-1E |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Metallothionein-1E Antibody from Novus Biologicals is a rabbit polyclonal antibody to Metallothionein-1E. This antibody reacts with human. The Metallothionein-1E Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TSCKKSECGAISRNLGLWLRLGGNSRLALSASFWGTGLSLPSLPVSFPLQAFCPKFRWGRTAFFSWDTNPNCTPYGFRTELCQTKKSILWVWV |
|---|
| Other Names | metallothionein 1E, metallothionein 1E (functional), metallothionein D, metallothionein-1E, metallothionein-IE, MT1, MT-1E, MTD, MT-IE |
|---|
| Gene, Accession # | MT1E, Gene ID: 4493 |
|---|
| Catalog # | NBP1-87740 |
|---|
| Price | |
|---|
| Order / More Info | Metallothionein-1E Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|