| Edit |   |
| Antigenic Specificity | CXorf40B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 74%, rat 79%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human CXorf40B polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: YAGFVLNGIKTVETRWRPLLSSQRNCTIAVHIAHRDWE |
| Other Names | chromosome X open reading frame 40B |
| Gene, Accession # | Gene ID: 541578, UniProt: Q96DE9, ENSG00000197021 |
| Catalog # | HPA060897 |
| Price | |
| Order / More Info | CXorf40B Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |