| 产品详情 |
| Edit |   |
| Antigenic Specificity | Aspartate Aminotransferase |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Aspartate Aminotransferase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aspartate Aminotransferase. This antibody reacts with human, rat. The Aspartate Aminotransferase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to GOT1(glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)) The peptide sequence was selected from the N terminal of GOT1 (NP_002070). Peptide sequence MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAY |
| Other Names | aspartate aminotransferase, cytoplasmic, EC 2.6.1.1, GIG18, Glutamate oxaloacetate transaminase 1, glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1), growth-inhibiting protein 18, Transaminase A |
| Gene, Accession # | GOT1, Gene ID: 2805, Accession: P17174, SwissProt: P17174 |
| Catalog # | NBP1-54778 |
| Price | |
| Order / More Info | Aspartate Aminotransferase Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 18242760, 23535601, 24611772, 27623078, 29321164, 29375049, 29661856, 30811976 |
| 产品资料 |
|
|