| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ESRP2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, zebrafish |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended.IP, WB reported in the scientific literature (PMID: 29180615). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ESRP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ESRP2. This antibody reacts with human, zebrafish. The ESRP2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human, zebrafish ESRP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EFHMQHPSTCPARDLTVATMAQGLGLETDATEDDFGVWEVKTMVAVILHL LKEPSSQLFSKPEVIKQKYETGPCSKADVVDSETVV |
|---|
| Other Names | epithelial splicing regulatory protein 2, FLJ21918, FLJ22248, RBM35BRNA-binding protein 35B, RNA binding motif protein 35A, RNA binding motif protein 35B, RNA-binding motif protein 35B |
|---|
| Gene, Accession # | ESRP2, Gene ID: 80004 |
|---|
| Catalog # | NBP2-13972 |
|---|
| Price | |
|---|
| Order / More Info | ESRP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26522722, 29180615, 29805042 |
|---|
| 产品资料 |
|
|