| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DUSP26 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DUSP26 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DUSP26. This antibody reacts with human. The DUSP26 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DUSP26 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVL |
|---|
| Other Names | DSP-4, dual specificity phosphatase 26 (putative), Dual specificity phosphatase SKRP3, dual specificity protein phosphatase 26, dual-specificity phosphatase SKRP3, DUSP24SKRP3, EC 3.1.3.16, EC 3.1.3.48, LDP4, LDP-4, Low-molecular-mass dual-specificity phosphatase 4, MAP kinase phosphatase 8, MGC1136, MGC2627, Mitogen-activated protein kinase phosphatase 8, MKP8, MKP-8, NATA1, Novel amplified gene in thyroid anaplastic cancer |
|---|
| Gene, Accession # | DUSP26, Gene ID: 78986, Accession: Q9BV47, SwissProt: Q9BV47 |
|---|
| Catalog # | NBP2-33880 |
|---|
| Price | |
|---|
| Order / More Info | DUSP26 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|