Edit |   |
Antigenic Specificity | Cholinergic Receptor, Nicotinic, alpha 1 (Muscle) (CHRNA1) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. |
Immunogen | CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV |
Other Names | CHRNA1|ACHRA|ACHRD|CHRNA|CMS2A|FCCMS|SCCMS|NACHRA1|AI385656|AI608266|Achr-1|Acra |
Gene, Accession # | Gene ID: 1134 |
Catalog # | ABIN633174 |
Price | |
Order / More Info | Cholinergic Receptor, Nicotinic, alpha 1 (Muscle) (CHRNA1) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |