| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ANKRD45 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRD45 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD45. This antibody reacts with human. The ANKRD45 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ANKRD45 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDTSN |
|---|
| Other Names | ankyrin repeat domain 45, ankyrin repeat domain-containing protein 45, cancer/testis antigen 117, CT117, FLJ45235, MGC161631, MGC161633, RP3-436N22.4 |
|---|
| Gene, Accession # | ANKRD45, Gene ID: 339416, Accession: Q5TZF3, SwissProt: Q5TZF3 |
|---|
| Catalog # | NBP1-85421 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD45 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|