| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ANKRD44 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRD44 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD44. This antibody reacts with human. The ANKRD44 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human ANKRD44 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASIFVKDNVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTP |
|---|
| Other Names | ankyrin repeat domain 44, FLJ11570, MGC21968, MGC70444, PP6-ARS-BAnkyrin repeat domain-containing protein 44, protein phosphatase 6 ankyrin repeat subunit B, serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B, Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B |
|---|
| Gene, Accession # | ANKRD44, Gene ID: 91526 |
|---|
| Catalog # | NBP2-56740 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD44 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|