| 产品详情 |
| Edit |   |
| Antigenic Specificity | ANKRD44 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ELISA reported in scientific literature (PMID 29310668). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ANKRD44 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD44. This antibody reacts with human. The ANKRD44 Antibody has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ANKRD44 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TALHYAAASDMDRNKTILGNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIR |
| Other Names | ankyrin repeat domain 44, FLJ11570, MGC21968, MGC70444, PP6-ARS-BAnkyrin repeat domain-containing protein 44, protein phosphatase 6 ankyrin repeat subunit B, serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B, Serine/threonine-protein phosphatase 6 regulatory subunit ARS-B |
| Gene, Accession # | ANKRD44, Gene ID: 91526, Accession: Q8N8A2, SwissProt: Q8N8A2 |
| Catalog # | NBP1-80887 |
| Price | |
| Order / More Info | ANKRD44 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 29310668 |
| 产品资料 |
|
|