Edit |   |
Antigenic Specificity | Ankyrin Repeat and SOCS Box-Containing 11 (ASB11) (C-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ASB11 is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. |
Immunogen | ASB11 antibody was raised using the C terminal of ASB11 corresponding to a region with amino acids GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV |
Other Names | ASB11|asb-a|zgc:136370|zgc:158532|DKFZp468G0324|1110067L12Rik|1600009D24Rik|RGD1566298 |
Gene, Accession # | Gene ID: 140456 |
Catalog # | ABIN632206 |
Price | |
Order / More Info | Ankyrin Repeat and SOCS Box-Containing 11 (ASB11) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |