Edit |   |
Antigenic Specificity | Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ANKS3 contains 1 SAM (sterile alpha motif) domain and 6 ANK repeats. The exact function of ANKS3 remains unknown. |
Immunogen | ANKS3 antibody was raised using the N terminal of ANKS3 corresponding to a region with amino acids WHGLGTQVSGEELDVPLDLHTAASIGQYEVVKECVQRRELDLNKKNGGGW |
Other Names | 2700067D09Rik|C81345|mKIAA1977|RGD1305833 |
Gene, Accession # | Gene ID: 124401,72615 |
Catalog # | ABIN632034 |
Price | |
Order / More Info | Ankyrin Repeat and SAM Domain-Containing Protein 3 (ANKS3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |