Edit |   |
Antigenic Specificity | Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The function of Ankyrin protein is not widely studied, and is yet to be elucidated fully. |
Immunogen | ANKMY2 antibody was raised using the N terminal of ANKMY2 corresponding to a region with amino acids DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL |
Other Names | Gna14|ankmy2|si:dkeyp-25a3.5|ZMYND20|AI035571 |
Gene, Accession # | Gene ID: 57037 |
Catalog # | ABIN632127 |
Price | |
Order / More Info | Ankyrin Repeat and MYND Domain Containing 2 (ANKMY2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |