Edit |   |
Antigenic Specificity | Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | KIAA0692 is a single-pass membrane protein. It contains 1 ANK repeat and 1 LEM domain. It contains 1 RING-type zinc finger. The function of KIAA0692 remains unknown. |
Immunogen | KIAA0692 antibody was raised using the middle region of Kiaa0692 corresponding to a region with amino acids CYSPSDRQSWPSPAVKGRFKSQLPDLSGPHSYSPGRNSVAGSNPAKPGLG |
Other Names | KIAA0692|LEMD7|Lem4|1110001J12Rik|AI661024|D5Ertd585e|RGD1310191 |
Gene, Accession # | Gene ID: 23141 |
Catalog # | ABIN631827 |
Price | |
Order / More Info | Ankyrin Repeat and LEM Domain Containing 2 (ANKLE2) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |