| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Myelin PLP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-Myelin PLP Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Myelin PLP (37-70aa HEALTGTEKLIETYFSKNYQDYEYLINVIHAFQY), identical to the related mouse and rat sequences. |
|---|
| Other Names | myelin proteolipid protein isoform 1; Myelin proteolipid protein; myelin proteolipid protein; proteolipid protein 1; Lipophilin, PLP1; PLP1; PLP; PMD; HLD1; MMPL; SPG2; GPM6C; PLP/DM20; PLP; PLP |
|---|
| Gene, Accession # | PLP1, Gene ID: 5354, NCBI: NP_000524.3, UniProt: P60201 |
|---|
| Catalog # | MBS178632 |
|---|
| Price | |
|---|
| Order / More Info | Myelin PLP Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: PLP1 proteolipid protein 1 (Pelizaeus-Merzbacher disease, spastic paraplegia 2, uncomplicated). 2. Gorman, M. P., Golomb, M. R., Walsh, L. E., Hobson, G. M., Garbern, J. Y., Kinkel, R. P., Darras, B. T., Urion, D. K., Eksioglu, Y. Z. Steroid-responsive neurologic relapses in a child with a proteolipid protein-1 mutation. Neurology 68: 1305-1307, 2007. 3. Hobson, G. M., Davis, A. P., Stowell, N. C., Kolodny, E. H., Sistermans, E. A., de Coo, I. F. M., Funanage, V. L., Mark |
|---|
| 产品资料 |
|
|