| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFB9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFB9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFB9. This antibody reacts with human, mouse, rat. The NDUFB9 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat NDUFB9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQLQ |
|---|
| Other Names | B22, CI-B22, complex I B22 subunit, Complex I-B22, FLJ22885, LYR motif-containing protein 3, LYRM3DKFZp566O173, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9, NADH-ubiquinone oxidoreductase B22 subunit, UQOR22NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9 (22kD, B22) |
|---|
| Gene, Accession # | NDUFB9, Gene ID: 4715 |
|---|
| Catalog # | NBP1-88940 |
|---|
| Price | |
|---|
| Order / More Info | NDUFB9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|