| 产品详情 |
| Edit |   |
| Antigenic Specificity | NDUFB6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NDUFB6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFB6. This antibody reacts with human. The NDUFB6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NDUFB6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNK |
| Other Names | B17, CI, CI-B17, complex I, mitochondrial respiratory chain, B17 subunit, Complex I-B17, MGC13675, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6 (17kD, B17), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6, NADH-ubiquinone oxidoreductase B17 subunit, NADH-ubiquinone oxidoreductase beta subunit, 6 |
| Gene, Accession # | NDUFB6, Gene ID: 4712 |
| Catalog # | NBP1-92172 |
| Price | |
| Order / More Info | NDUFB6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 25605331 |
| 产品资料 |
|
|