| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFB5 |
|---|
| Clone | 5G5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFB5 Antibody (5G5) from Novus Biologicals is a mouse monoclonal antibody to NDUFB5. This antibody reacts with human. The NDUFB5 Antibody (5G5) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | NDUFB5 (NP_002483, 95 a.a. - 189 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
|---|
| Other Names | 5 (16kD, SGDH), CISGDH, CI-SGDH, Complex I-SGDH, DKFZp686N02262, FLJ30597, MGC111204, MGC12314, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, SGDH |
|---|
| Gene, Accession # | NDUFB5, Gene ID: 4711, Accession: NP_002483, SwissProt: NP_002483 |
|---|
| Catalog # | H00004711-M01 |
|---|
| Price | |
|---|
| Order / More Info | NDUFB5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|