| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFB5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFB5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFB5. This antibody reacts with human, mouse. The NDUFB5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen. Specificity of human NDUFB5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
|---|
| Other Names | 5 (16kD, SGDH), CISGDH, CI-SGDH, Complex I-SGDH, DKFZp686N02262, FLJ30597, MGC111204, MGC12314, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial, SGDH |
|---|
| Gene, Accession # | NDUFB5, Gene ID: 4711 |
|---|
| Catalog # | NBP1-85607 |
|---|
| Price | |
|---|
| Order / More Info | NDUFB5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|