| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NDUFB4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NDUFB4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NDUFB4. This antibody reacts with human. The NDUFB4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NDUFB4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQL |
|---|
| Other Names | B15, CI-B15, complex I B15 subunit, Complex I-B15, MGC5105, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4 (15kD, B15), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4, NADH-ubiquinone oxidoreductase B15 subunit |
|---|
| Gene, Accession # | NDUFB4, Gene ID: 4710, Accession: O95168, SwissProt: O95168 |
|---|
| Catalog # | NBP2-33626 |
|---|
| Price | |
|---|
| Order / More Info | NDUFB4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|