| Edit |   |
|---|
| Antigenic Specificity | METTL5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | METTL5 antibody. Specificity: METTL5 antibody was raised against the N terminal of METTL5 |
|---|
| Immunogen | METTL5 antibody was raised using the N terminal of METTL5 corresponding to a region with amino acids KKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIE |
|---|
| Other Names | METTL5 protein; Methyltransferase-like protein 5; methyltransferase-like protein 5; methyltransferase like 5, METTL5; METTL5; HSPC133 |
|---|
| Gene, Accession # | METTL5, Gene ID: 29081, NCBI: AAH93014.1 |
|---|
| Catalog # | MBS5303170 |
|---|
| Price | |
|---|
| Order / More Info | METTL5 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|