Edit |   |
Antigenic Specificity | Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones. |
Immunogen | AKR7 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW |
Other Names | AFAR2|fd56g11|wu:fd56g11|zgc:92502|AKR7A2|Afar|Akr7a1 |
Gene, Accession # | Gene ID: 22977 |
Catalog # | ABIN632796 |
Price | |
Order / More Info | Aldo-Keto Reductase Family 7, Member A3 (Aflatoxin Aldehyde Reductase) (AKR7A3) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |