| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DNase II |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DNase II Antibody from Novus Biologicals is a rabbit polyclonal antibody to DNase II. This antibody reacts with human. The DNase II Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DNase II antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSR |
|---|
| Other Names | Acid DNase, Deoxyribonuclease II alpha, deoxyribonuclease II, lysosomal, deoxyribonuclease-2-alpha, DNase II alpha, DNase II, lysosomal, DNASE2A, DNL, DNL2, EC 3.1.22.1, Lysosomal DNase II, R31240_2 |
|---|
| Gene, Accession # | DNASE2, Gene ID: 1777, Accession: O00115, SwissProt: O00115 |
|---|
| Catalog # | NBP2-39068 |
|---|
| Price | |
|---|
| Order / More Info | DNase II Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|