| Edit |   |
| Antigenic Specificity | SHISA4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 96%, rat 96%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human SHISA4 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DCLWYLDRNGSWHPGFNCEFFTFCCGTCYHRYCCRDLTLLITERQQKHCL |
| Other Names | shisa family member 4, C1orf40, hShisa4, TMEM58 |
| Gene, Accession # | Gene ID: 149345, UniProt: Q96DD7, ENSG00000198892 |
| Catalog # | HPA061273 |
| Price | |
| Order / More Info | SHISA4 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |