Edit |   |
Antigenic Specificity | Arachidonate 15-Lipoxygenase B (ALOX15B) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. |
Immunogen | ALOX15 B antibody was raised using the N terminal of ALOX15 corresponding to a region with amino acids MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAE |
Other Names | ALOX15B|15-LOX-2|15-LOX-B|8-LOX|8S-LOX|Alox15b |
Gene, Accession # | Gene ID: 247 |
Catalog # | ABIN631457 |
Price | |
Order / More Info | Arachidonate 15-Lipoxygenase B (ALOX15B) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |