| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KMT2D |
|---|
| Clone | 2E1 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. It has been used for ELISA. WB has been performed on the partial recombinant protein used to immunize this product. It has not yet been tested for detection of the full length protein or endogenous detection. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KMT2D Antibody (2E1) from Novus Biologicals is a mouse monoclonal antibody to KMT2D. This antibody reacts with human. The KMT2D Antibody (2E1) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MLL2 (NP_003473.1 1487 a.a. - 1586 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVKASPVPSDPE |
|---|
| Other Names | AAD10, ALRALL1-related protein, CAGL114, EC 2.1.1.43, histone-lysine N-methyltransferase MLL2, KMT2D, Lysine N-methyltransferase 2B, MLL4, myeloid/lymphoid or mixed-lineage leukemia 2, Myeloid/lymphoid or mixed-lineage leukemia protein 2, TNRC21, trinucleotide repeat containing 21 |
|---|
| Gene, Accession # | MLL2, Gene ID: 8085, Accession: NP_003473, SwissProt: NP_003473 |
|---|
| Catalog # | H00008085-M01 |
|---|
| Price | |
|---|
| Order / More Info | KMT2D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24633898 |
|---|
| 产品资料 |
|
|