Edit |   |
Antigenic Specificity | Bleomycin Hydrolase (BLMH) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity. |
Immunogen | BLMH antibody was raised using the middle region of BLMH corresponding to a region with amino acids EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL |
Other Names | AI035728|Bh|Bmh|wu:fb13c01|zgc:66261|bh|bmh|BH|BMH |
Gene, Accession # | Gene ID: 642,104184,287552 |
Catalog # | ABIN631453 |
Price | |
Order / More Info | Bleomycin Hydrolase (BLMH) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |