Edit |   |
Antigenic Specificity | Nucleolar Protein 6 (NOL6) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. |
Immunogen | NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR |
Other Names | NRAP|UTP22|bA311H10.1|nrap|utp22|AA410091|Nrap |
Gene, Accession # | Gene ID: 65083,230082,313167 |
Catalog # | ABIN633317 |
Price | |
Order / More Info | Nucleolar Protein 6 (NOL6) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |