Edit |   |
Antigenic Specificity | Exosome Component 4 (EXOSC4) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat, dog |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity. |
Immunogen | EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE |
Other Names | EXOSC4|zgc:73175|RRP41|RRP41A|Rrp41p|SKI6|Ski6p|hRrp41p|p12A|1110039I09Rik|1500001N04Rik|Rrp41 |
Gene, Accession # | Gene ID: 54512,482086,109075,300045 |
Catalog # | ABIN629903 |
Price | |
Order / More Info | Exosome Component 4 (EXOSC4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |