Edit |   |
Antigenic Specificity | Exosome Component 3 (EXOSC3) (C-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. |
Immunogen | EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL |
Other Names | PCH1B|RP11-3J10.8|RRP40|Rrp40p|bA3J10.7|hRrp-40|p10|2310005D06Rik|AI593501|Rrp40|im:7140537|zgc:112345 |
Gene, Accession # | Gene ID: 51010 |
Catalog # | ABIN633247 |
Price | |
Order / More Info | Exosome Component 3 (EXOSC3) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |