Edit |   |
Antigenic Specificity | Exosome Component 10 (EXOSC10) (C-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma. |
Immunogen | EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG |
Other Names | Pmscl2|zgc:55695|pm-scl|pm/scl-100|pmscl|pmscl2|rrp6|rrp6p|EXOSC10|201.t00018|21.m02990|DDBDRAFT_0203581|DDBDRAFT_0233752|DDB_0203581|DDB_0233752|PM-Scl|PM/Scl-100|PMSCL|PMSCL2|RRP6|Rrp6p|p2|p3|p4 |
Gene, Accession # | Gene ID: 5394 |
Catalog # | ABIN629904 |
Price | |
Order / More Info | Exosome Component 10 (EXOSC10) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |