| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Exosome Component 9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Exosome Component 9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Exosome Component 9. This antibody reacts with human. The Exosome Component 9 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Exosome Component 9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PNEREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGGKFGFAESIANQRITA |
|---|
| Other Names | Autoantigen PM/Scl 1, EC 3.1.13, exosome component 9Polymyositis/scleroderma autoantigen 75 kDa, p6, PM/Scl-75P75 polymyositis-scleroderma overlap syndrome-associated autoantigen, PMSCL175kD, Polymyositis/scleroderma autoantigen 1, polymyositis/scleroderma autoantigen 1 (75kD), polymyositis/scleroderma autoantigen 1, 75kDa |
|---|
| Gene, Accession # | EXOSC9, Gene ID: 5393 |
|---|
| Catalog # | NBP2-57565 |
|---|
| Price | |
|---|
| Order / More Info | Exosome Component 9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|