| 产品详情 |
| Edit |   |
| Antigenic Specificity | Exosome component 8 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Exosome component 8 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Exosome component 8. This antibody reacts with human. The Exosome component 8 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Exosome component 8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VEPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFR |
| Other Names | bA421P11.3, CBP-interacting protein 3, CIP3, EAP2, exosome complex exonuclease RRP43, exosome component 8Opa-interacting protein 2, OIP2Ribosomal RNA-processing protein 43, Opa interacting protein 2, p9RP11-421P11.3, RRP43OIP-2, Rrp43p |
| Gene, Accession # | EXOSC8, Gene ID: 11340 |
| Catalog # | NBP2-47466 |
| Price | |
| Order / More Info | Exosome component 8 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|