Edit |   |
Antigenic Specificity | Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. |
Immunogen | SLC25 A21 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGIL |
Other Names | zgc:153387|ODC|ODC1|Odc1|9930033G19Rik|A630030I10|BB158148 |
Gene, Accession # | Gene ID: 89874 |
Catalog # | ABIN635066 |
Price | |
Order / More Info | Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |