| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The mitochondrial tricarboxylate transporter (also called citrate transport protein, or CTP) is responsible for the movement of citrate across the mitochondrial inner membrane. |
|---|
| Immunogen | SLC25 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGL |
|---|
| Other Names | MGC53598|slc25a1|zgc:63578|ctp|slc20a3|CG31305|CG6782|DmCIC|Dmel\\CG6782|SLC25A1|anon-WO0140519.12|l(3)EP3364|NV14384|1300019P08Rik|2610100G11Rik|AI194714|Ctp|Dgsj|Slc20a3|Cic|CTP|D2L2AD|SEA|SLC20A3 |
|---|
| Gene, Accession # | Gene ID: 6576 |
|---|
| Catalog # | ABIN635081 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 25 (Mitochondrial Carrier, Citrate Transporter), Member 1 (Slc25a1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|