| Edit |   |
| Antigenic Specificity | EEF1B2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot. Band seen at 32 kDa in Western blot. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EEF1B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EEF1B2. This antibody reacts with human. The EEF1B2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to EEF1B2(eukaryotic translation elongation factor 1 beta 2) The peptide sequence was selected from the middle region of EEF1B2 (NP_066944). Peptide sequence VKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREE. |
| Other Names | EEF1B, EEF1B1, EF1B, EF-1-beta, elongation factor 1-beta, eukaryotic translation elongation factor 1 beta 1, eukaryotic translation elongation factor 1 beta 2 |
| Gene, Accession # | EEF1B2, Gene ID: 1933, Accession: P24534, SwissProt: P24534 |
| Catalog # | NBP1-53035-20ul |
| Price | |
| Order / More Info | EEF1B2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |