Edit |   |
Antigenic Specificity | Acyl-CoA Dehydrogenase, C-4 To C-12 Straight Chain (ACADM) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, dog |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency. |
Immunogen | ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG |
Other Names | acaDM|ACAD1|MCAD|MCADH|AU018656 |
Gene, Accession # | Gene ID: 34,490207 |
Catalog # | ABIN629681 |
Price | |
Order / More Info | Acyl-CoA Dehydrogenase, C-4 To C-12 Straight Chain (ACADM) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |