| Edit |   |
|---|
| Antigenic Specificity | Acyl-CoA Dehydrogenase, C-4 To C-12 Straight Chain (ACADM) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, dog |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACADM Is the medium-chain specific (C4 to C12 straight chain) acyl-Coenzyme A dehydrogenase. The homotetramer enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Clinical phenotypes are associated with ACADM hereditary deficiency. |
|---|
| Immunogen | ACADM antibody was raised using the N terminal of ACADM corresponding to a region with amino acids ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG |
|---|
| Other Names | acaDM|ACAD1|MCAD|MCADH|AU018656 |
|---|
| Gene, Accession # | Gene ID: 34,490207 |
|---|
| Catalog # | ABIN629681 |
|---|
| Price | |
|---|
| Order / More Info | Acyl-CoA Dehydrogenase, C-4 To C-12 Straight Chain (ACADM) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|