| Edit |   |
| Antigenic Specificity | MTCP1 |
| Clone | 1G12 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2b kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MTCP1 Antibody (1G12) from Novus Biologicals is a mouse monoclonal antibody to MTCP1. This antibody reacts with human. The MTCP1 Antibody (1G12) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | MTCP1 (AAH02600, 1 a.a. - 68 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK |
| Other Names | mature T-cell proliferation 1, P13MTCP1 |
| Gene, Accession # | MTCP1, Gene ID: 4515, Accession: AAH02600, SwissProt: AAH02600 |
| Catalog # | H00004515-M05 |
| Price | |
| Order / More Info | MTCP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |