Edit |   |
Antigenic Specificity | Clavesin 1 (CLVS1) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse, rat |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | RLBP1L1 contains 1 CRAL-TRIO domain. It may be used as a marker for human hepatocellular carcinomas. |
Immunogen | RLBP1 L1 antibody was raised using the middle region of RLBP1 1 corresponding to a region with amino acids MFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFT |
Other Names | RLBP1L1|rlbp1l1|CRALBPL|4933402J24Rik|Clvl1|Rlbp1l1|Clavesin-1|RGD1564200 |
Gene, Accession # | Gene ID: 157807,74438,366311 |
Catalog # | ABIN631450 |
Price | |
Order / More Info | Clavesin 1 (CLVS1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |