Edit |   |
Antigenic Specificity | Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | GAPDHS is a protein belonging to the glyceraldehyde-3-phosphate dehydrogenase family of enzymes that play an important role in carbohydrate metabolism. |
Immunogen | GAPDHS antibody was raised using the N terminal of GAPDHS corresponding to a region with amino acids PFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQI |
Other Names | GAPDS|GAPDHS|GAPD2|GAPDH-2|HSD-35|Gapd-s|Gapds|gapdh-2|cb350|fb71f08|fk58c09|g3pdh|gapdh|gapds|wu:fb71f08|wu:fk58c09|zgc:76908 |
Gene, Accession # | Gene ID: 26330 |
Catalog # | ABIN631607 |
Price | |
Order / More Info | Glyceraldehyde-3-Phosphate Dehydrogenase, Spermatogenic (GAPDHS) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |