| Edit |   |
| Antigenic Specificity | RBM9 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | RBM9 antibody. Specificity: RBM9 antibody was raised against the middle region of RBM9 |
| Immunogen | RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT |
| Other Names | RBM9; RNA binding protein fox-1 homolog 2; Fox-1 homolog B; Hexaribonucleotide-binding protein 2; RNA-binding motif protein 9; RNA-binding protein 9; Repressor of tamoxifen transcriptional activity, RBFOX2; FOX2; HRNBP2; RBM9; RTA |
| Gene, Accession # | RBM9, NCBI: CAG30445.1, UniProt: O43251 |
| Catalog # | MBS5301091 |
| Price | |
| Order / More Info | RBM9 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |